Skip to Content
MilliporeSigma
All Photos(6)

Documents

WH0002934M1

Sigma-Aldrich

Monoclonal Anti-GSN antibody produced in mouse

clone 3G5, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-DKFZp313L0718, Anti-gelsolin (amyloidosis, Finnish type)

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

3G5, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
immunoprecipitation (IP): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG1κ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... GSN(2934)

General description

Gelsolin (GSN) gene codes for gelsolin, a calcium-regulated actin regulatory protein. The GSN gene is mapped on human chromosome 9q33.2.

Immunogen

GSN (AAH26033, 673 a.a. ~ 782 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSVDPLDRAMAELAA

Biochem/physiol Actions

Gelsolin (GSN) protein plays a key role in inflammation, cell movement, apoptosis, and cancer progression. It can prevent the fibrillization of β-amyloid protein (Aβ) and defibrillate its produced fibrils. Mutations of the GSN gene can result in hereditary amyloidosis (HA). The deposition of amyloid fibrils formed from the gelsolin protein in many organs and tissues is characterized by familial amyloidosis, Finnish type (FAF), or AGel amyloidosis (AGel).

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Zhen-Yu Li et al.
Frontiers in medicine, 9, 869409-869409 (2022-05-17)
Fibrinogen A alpha-chain amyloidosis (AFib amyloidosis) is the most common form of hereditary renal amyloidosis in the United Kingdom and Europe, but has rarely been reported in Asia. In this study, we reported two AFib amyloidosis patients in China, reviewing
Habiba Zorgati et al.
Proceedings of the National Academy of Sciences of the United States of America, 116(28), 13958-13963 (2019-06-28)
In the disease familial amyloidosis, Finnish type (FAF), also known as AGel amyloidosis (AGel), the mechanism by which point mutations in the calcium-regulated actin-severing protein gelsolin lead to furin cleavage is not understood in the intact protein. Here, we provide
Yaling Jiang et al.
Frontiers in aging neuroscience, 12, 581524-581524 (2020-11-17)
Amyloid protein deposition is a common mechanism of hereditary amyloidosis (HA) and Alzheimer's disease (AD). Mutations of gelsolin (GSN), cystatin C (CST3), transthyretin (TTR), and integral membrane protein 2B (ITM2B) genes can lead to HA. But the relationship is unclear

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service