WH0002295M3

Monoclonal Anti-FOXF2 antibody produced in mouse

clone 3F5, purified immunoglobulin, buffered aqueous solution

• Synonym(s): Anti-FKHL6, Anti-FREAC2, Anti-forkhead box F2
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 3F5, monoclonal
• form: buffered aqueous solution
• species reactivity: human, mouse, rat
• technique(s): indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• isotype: IgG2bκ
• GenBank accession no.: NM_001452
• UniProt accession no.: Q12947
• shipped in: dry ice
• storage temp.: −20°C
• Gene Information: human ... FOXF2(2295)

Description

General description

FOXF2 encodes forkhead box F2, one of many human homologues of the Drosophila melanogaster transcription factor forkhead. FOXF2 is expressed in lung and placenta, and has been shown to transcriptionally activate several lung-specific genes. (provided by RefSeq).
Forkhead box F2 (FOXF2) belongs to the large family of forkhead transcription factors. FOXF2 gene is located on human chromosome 6p25.3.

Immunogen

FOXF2 (NP_001443, 346 a.a. ~ 443 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SPYLKQPPALTPSSNPAASAGLHSSMSSYSLEQSYLHQNAREDLSVGLPRYQHHSTPVCDRKDFVLNFNGISSFHPSASGSYYHHHHQSVCQDIKPCV

Biochem/physiol Actions

Forkhead box F2 (FOXF2) helps in the epitheliomesenchymal interactions and cell differentiation of the central nervous system. It acts as a developmental regulator in palatogenesis. FOXF2 is involved in tissue development and extracellular matrix synthesis. FOXF2 is indicated in the prognosis of esophageal squamous cell carcinoma. FOXF2 acts either as a tumor suppressor or an oncogene, depending on the breast tumor subtype.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 12 - Non Combustible Liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)