Skip to Content
MilliporeSigma
All Photos(4)

Key Documents

WH0002295M3

Sigma-Aldrich

Monoclonal Anti-FOXF2 antibody produced in mouse

clone 3F5, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-FKHL6, Anti-FREAC2, Anti-forkhead box F2

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

3F5, monoclonal

form

buffered aqueous solution

species reactivity

human, mouse, rat

technique(s)

indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

isotype

IgG2bκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

Gene Information

human ... FOXF2(2295)

General description

FOXF2 encodes forkhead box F2, one of many human homologues of the Drosophila melanogaster transcription factor forkhead. FOXF2 is expressed in lung and placenta, and has been shown to transcriptionally activate several lung-specific genes. (provided by RefSeq).
Forkhead box F2 (FOXF2) belongs to the large family of forkhead transcription factors. FOXF2 gene is located on human chromosome 6p25.3.

Immunogen

FOXF2 (NP_001443, 346 a.a. ~ 443 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SPYLKQPPALTPSSNPAASAGLHSSMSSYSLEQSYLHQNAREDLSVGLPRYQHHSTPVCDRKDFVLNFNGISSFHPSASGSYYHHHHQSVCQDIKPCV

Biochem/physiol Actions

Forkhead box F2 (FOXF2) helps in the epitheliomesenchymal interactions and cell differentiation of the central nervous system. It acts as a developmental regulator in palatogenesis. FOXF2 is involved in tissue development and extracellular matrix synthesis. FOXF2 is indicated in the prognosis of esophageal squamous cell carcinoma. FOXF2 acts either as a tumor suppressor or an oncogene, depending on the breast tumor subtype.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

12 - Non Combustible Liquids

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

The FOXF2 pathway in the human prostate stroma
van der Heul-Nieuwenhuijsen L, et al.
Prostate, 69(14) (2009)
Decreased FOXF2 mRNA expression indicates early-onset metastasis and poor prognosis for breast cancer patients with histological grade II tumor
Kong P, et al.
PLoS ONE, 8(4), e61591-e61591 (2013)
The dual role of FOXF2 in regulation of DNA replication and the epithelial-mesenchymal transition in breast cancer progression
Lo P, et al.
Cellular Signalling, 28(10) (2016)
FOXF2 promoter methylation is associated with prognosis in esophageal squamous cell carcinoma
Chen X, et al.
Tumour Biology : the Journal of the International Society For Oncodevelopmental Biology and Medicine, 39(2), 1010428317692230-1010428317692230 (2017)
Tao Wang et al.
Developmental biology, 259(1), 83-94 (2003-06-19)
The forkhead genes encode a transcription factor involved in embryogenesis and pattern formation in multicellular organisms. They are mammalian transcriptional regulators that bind DNA as a monomer through their forkhead domain. The Foxf2 (LUN) mRNA is expressed in the mesenchyme

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service