Skip to Content
MilliporeSigma
All Photos(1)

Key Documents

WH0001807M1

Sigma-Aldrich

Monoclonal Anti-DPYS antibody produced in mouse

clone 3B1, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-DHP, Anti-DHPase, Anti-dihydropyrimidinase

Sign Into View Organizational & Contract Pricing

Select a Size

100 μG
$406.00

$406.00


Ships within 2 weeks. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)


Select a Size

Change View
100 μG
$406.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

$406.00


Ships within 2 weeks. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

3B1, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable

isotype

IgG1κ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... DPYS(1807)

Related Categories

General description

Dihydropyrimidinase catalyzes the conversion of 5,6-dihydrouracil to 3-ureidopropionate in pyrimidine metabolism. Dihydropyrimidinase is expressed at a high level in liver and kidney as a major 2.5-kb transcript and a minor 3.8-kb transcript. Defects in the DPYS gene are linked to dihydropyrimidinuria. (provided by RefSeq)
The gene DPYS (dihydropyrimidinase) is mapped to human chromosome 8q22. It is mainly expressed in the liver and kidney cells.

Immunogen

DPYS (NP_001376, 422 a.a. ~ 519 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
AVNFNIFEGMVCHGVPLVTISRGKVVYEAGVFSVTAGDGKFIPRKPFAEYIYKRIKQRDRTCTPTPVERAPYKGEVATLKSRVTKEDATAGTRKQAHP

Biochem/physiol Actions

DPYS (dihydropyrimidinase) is an enzyme of the pyrimidine degradation pathway and is responsible for the ring opening of 5,6-dihydrouracil and 5,6-dihydrothymine. Mutations in the DPYS gene can lead to dihydropyrimidinase deficiency, associated with a large accumulation of dihydrouracil and dihydrothymine in urine, blood and cerebrospinal fluid. Methylation pattern in DPYS gene might predict prostate cancer-related mortality.{33)

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

DNA methylation gene-based models indicating independent poor outcome in prostate cancer.
Vasiljevic N, et al.
BMC Cancer, 14(1), 655-655 (2014)
Altered Pre-mRNA Splicing Caused by a Novel Intronic Mutation c.1443+5G>A in the Dihydropyrimidinase (DPYS) Gene.
Nakajima Y, et al.
International Journal of Molecular Sciences, 17(1), 86-86 (2016)
André B P van Kuilenburg et al.
Biochimica et biophysica acta, 1802(7-8), 639-648 (2010-04-07)
Dihydropyrimidinase (DHP) is the second enzyme of the pyrimidine degradation pathway and catalyses the ring opening of 5,6-dihydrouracil and 5,6-dihydrothymine. To date, only 11 individuals have been reported suffering from a complete DHP deficiency. Here, we report on the clinical

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service