WH0001231M1

Monoclonal Anti-CCR2 antibody produced in mouse

clone 4D12, ascites fluid

• Synonym(s): Anti-CCCKR2, Anti-CCR2A, Anti-CCR2B, Anti-CKR2, Anti-CKR2A, Anti-CKR2B, Anti-CMKBR2, Anti-MCP1R, Anti-chemokine (C-C motif) receptor 2
• MDL number: MFCD01864606
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: ascites fluid
• antibody product type: primary antibodies
• clone: 4D12, monoclonal
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1:500-1:1000
• isotype: IgMκ
• GenBank accession no.: NM_000648
• UniProt accession no.: P41597
• shipped in: dry ice
• storage temp.: −20°C
• Gene Information: human ... CCR2(1231)

Description

General description

C-C motif chemokine receptor 2 (CCR2) is encoded by the gene mapped to human chromosome 3p21.31. The encoded protein is a membrane-spanning G protein-coupled receptor for C-C motif chemokine ligand 2 (CCL2) as well as CCL7 and CCL13. CCR2 is a member of chemokine receptor subfamily of human class A G-protein-coupled receptors. The protein is expressed on monocytes, immature dendritic cells and T-cell subpopulations.

Immunogen

CCR2 (NP_000639, 1 a.a. ~ 42 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGA

Biochem/physiol Actions

C-C motif chemokine receptor 2 (CCR2) interacts with its ligand CCL2 and plays crucial roles in the muscle damage, repair and adaptation responses to eccentric exercise. The encoded protein is also implicated in maintenance of adipocyte function. In addition, it also regulates monocytes and macrophages trafficking, which are involved in development of atherosclerosis, obesity and type 2 diabetes. Mutations in the gene leads to exercise-induced muscle damage. Overexpression of CCR2 has been observed in nasopharyngeal carcinoma (NPC).

Physical form

Solution

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 12 - Non Combustible Liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)