Skip to Content
MilliporeSigma
All Photos(2)

Key Documents

WH0001107M1

Sigma-Aldrich

Monoclonal Anti-CHD3 antibody produced in mouse

clone 5E12, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-Mi2ALPHA, Anti-Mi2a, Anti-ZFH, Anti-chromodomain helicase DNA binding protein 3

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

5E12, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

Gene Information

human ... CHD3(1107)

General description

Chromodomain helicase DNA binding protein 3 (CHD3) is encoded by the gene mapped to human chromosome 17p13.1.The encoded protein belongs to the class II CHD protein family. CHD3 contains a pair of N-terminal plant homeodomain zinc fingers domains involved in chromatin-based transcriptional regulation.
This gene encodes a member of the CHD family of proteins which are characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. This protein is one of the components of a histone deacetylase complex referred to as the Mi-2/NuRD complex which participates in the remodeling of chromatin by deacetylating histones. Chromatin remodeling is essential for many processes including transcription. Autoantibodies against this protein are found in a subset of patients with dermatomyositis. Three alternatively spliced transcripts encoding different isoforms have been described. (provided by RefSeq)

Immunogen

CHD3 (NP_001005273, 1654 a.a. ~ 1741 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KPLDGQEHRERPEGETGDLGKREDVKGDRELRPGPRDEPRSNGRREEKTEKPRFMFNIADGGFTELHTLWQNEERAAISSGKLNEIWH

Biochem/physiol Actions

Chromodomain helicase DNA binding protein 3 (CHD3)/CHD4 is an essential element of nucleosome remodeling and deacetylase (NuRD) complex, which plays a crucial role in synapse formation and heart development. It also has an essential role in mediating transcriptional repression of several infecting viral genomes, including herpesvirus. Deletion or downregulated expression of the gene has been associated with breast cancer.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

12 - Non Combustible Liquids

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

The Chd Family of Chromatin Remodelers
Marfella CG and Imbalzano AN
Mutation Research, 618, 30-40 (2007)
Epigenetic repression of herpes simplex virus infection by the nucleosome remodeler CHD3.
Arbuckle JH and Kristie TM
mBio, 5, e01027-e01013 (2014)
Xiaofang Chu et al.
Molecular oncology, 11(10), 1348-1360 (2017-06-27)
Chromodomain helicase DNA binding proteins (CHDs) are characterized by N-terminal tandem chromodomains and a central adenosine triphosphate-dependent helicase domain. CHDs govern the cellular machinery's access to DNA, thereby playing critical roles in various cellular processes including transcription, proliferation, and DNA

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service