WH0000922M1

Monoclonal Anti-CD5L antibody produced in mouse

clone 1C8, purified immunoglobulin, buffered aqueous solution

• Synonym(s): Anti-API6, Anti-CD5 antigen-like (scavenger receptor cysteine rich family), Anti-PRO229, Anti-SPALPHA, Anti-Spalpha
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 1C8, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): immunoprecipitation (IP): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• GenBank accession no.: BC033586
• UniProt accession no.: O43866
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... CD5L(922)

Description

General description

CD5 molecule like (CD5L), also known as apoptosis inhibitor of macrophage (AIM), is encoded by the gene mapped to human chromosome 1q23.1. CD5L is a member of the scavenger receptor cysteine-rich (SRCR) superfamily. It is a soluble protein expressed generally by macrophages in lymphoid and inflamed tissues. This protein is characterized with a potential region of O-linked glycosylation in a Pro-Ser-Thr-rich polypeptide, separating SRCR domains 1 and 2.

Immunogen

CD5L (AAH33586, 41 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QKGQWGTVCDDGWDIKDVAVLCRELGCGAASGTPSGILYEPPAEKEQKVLIQSVSCTGTEDTLAQCEQEEVYDCSHDEDAGASCENPESSFSPVPEGVRL

Biochem/physiol Actions

CD5 molecule like (CD5L) controls lipid metabolism and regulates T-helper (Th) 17 cell pathogenicity. In addition, it also has an ability to regulate leukocyte migration and inflammatory responses. Overexpression of the protein has been observed in atopic dermatitis (AD) patients. Thus, it can be used as a potential biomarker for AD.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Safety Information

• Storage Class: 12 - Non Combustible Liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)