MRGPRX1 is an orphan receptor. MRGPRX1 is probably involved in the function of nociceptive neurons. It may regulate nociceptor function and/or development, including the sensation or modulation of pain. MRGPRX1 is potently activated by enkephalins including BAM22 (bovine adrenal medulla peptide 22) and BAM (8-22). BAM22 is the most potent compound and evoked a large and dose-dependent release of intracellular calcium in stably transfected cells. G(alpha)q proteins are involved in the calcium-signaling pathway. MRGPRX1 is activated by the antimalarial drug, chloroquine and may mediate chloroquine-induced itch, in an histamine-independent manner.
Immunogen
Synthetic peptide directed towards the C-terminal region of Human MRGPRX1
Sequence
Synthetic peptide located within the following region: FLSALNSSANPIIYFFVGSFRQRQNRQNLKLVLQRALQDASEVDEGGGQL
Physical form
Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk_germany
nwg
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Lot/Batch Number
It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documents section.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
