CRY1 is the blue light-dependent regulator of the circadian feedback loop. CRY1 inhibits CLOCK NPAS2-ARNTL E box-mediated transcription. CRY1 acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity. CRY1 has no photolyase activity. CRY1 is capable of translocating circadian clock core proteins such as PER proteins to the nucleus. CRY1 may inhibit CLOCK NPAS2-ARNTL transcriptional activity through stabilizing the unphosphorylated form of ARNTL.
Immunogen
Synthetic peptide directed towards the N terminal region of human CRY1
Sequence
Synthetic peptide located within the following region: KRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGF
Physical form
Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk_germany
nwg
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Lot/Batch Number
It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documents section.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
