Skip to Content
MilliporeSigma
All Photos(6)

Key Documents

SAB2108751

Sigma-Aldrich

Anti-ACCN2

affinity isolated antibody

Synonym(s):

Anti- ACCN2, Anti- ASIC1A, Anti- BNaC2, Anti- hBNaC2, Anti-ASIC

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
$541.00

$541.00


Usually ships in 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)

Notify Me

Get notified when this item is ready to ship via email.


Select a Size

Change View
100 μL
$541.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

$541.00


Usually ships in 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)

Notify Me

Get notified when this item is ready to ship via email.

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

65 kDa

species reactivity

rabbit, rat, dog, mouse, horse, guinea pig, human

concentration

0.5-1 mg/mL

technique(s)

immunoblotting: suitable

accession no.

NM_020039

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ACCN2(41)

Immunogen

Synthetic peptide directed towards the N terminal region of human ACCN2

Biochem/physiol Actions

ACCN2 is the cation channel with high affinity for sodium, which is gated by extracellular protons and inhibited by the diuretic amiloride. ACCN2 is also permeable for Ca2+, Li+ and K+. ACCN2 generates a biphasic current with a fast inactivating and a slow sustained phase. ACCN2 mediates glutamate-independent Ca2+ entry into neurons upon acidosis. This Ca2+ overloading is toxic for cortical neurons and may be in part responsible for ischemic brain injury. Heteromeric channel assembly seems to modulate channel properties. ACCN2 functions as a postsynaptic proton receptor that influences intracellular Ca2+ concentration and calmodulin-dependent protein kinase II phosphorylation and thereby the density of dendritic spines. It modulates activity in the circuits underlying innate fear.This gene encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, 2 hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing. The member encoded by this gene is expressed in most if not all brain neurons, and it may be an ion channel subunit; however, its function as an ion channel remains unknown. Alternative splicing of this gene generates 2 transcript products.

Sequence

Synthetic peptide located within the following region: MELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCF

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Wen-Fan Gao et al.
International journal of molecular medicine, 43(4), 1778-1788 (2019-02-06)
Acid‑sensing ion channel 1a (ASIC1a), member of the degenerin/epithelial sodium channel protein superfamily, serves a critical role in various physiological and pathological processes. The aim of the present study was to examine the role of ASIC1a in the autophagy of

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service