B-cell lymphoma 2 associated X (BAX), also known as CLECSF10 (C-type lectin superfamily member 10), is located on human chromosome 19q13. BAX is a proapoptotic protein and is a member of Bcl-2 protein family.
Immunogen
Synthetic peptide directed towards the N terminal region of human BAX
B-cell lymphoma 2 associated X (BAX) promotes cell death and plays a vital role in regulation of apoptosis. BAX gene may act as a negative regulator of autophagy in CRC (colorectal cancer) development.
Sequence
Synthetic peptide located within the following region: MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPV
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.