SAB2108103

Anti-CNOT6 antibody produced in rabbit

affinity isolated antibody

• UNSPSC Code: 12352203

Properties

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 63kDa
• species reactivity: bovine, dog, rat, pig, horse, human, rabbit
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunoblotting: suitable
• NCBI accession no.: NM_015455
• UniProt accession no.: Q9ULM6
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... CNOT6(57472)

Description

Immunogen

Synthetic peptide directed towards the N terminal region of human CNOT6

Biochem/physiol Actions

CNOT6 is a subunit of the CCR4-NOT core transcriptional regulation complex. CNOT6 has a 3′-5′ RNase activity and prefers polyadenylated substates.The protein encoded by this gene is a subunit of the CCR4-NOT core transcriptional regulation complex. The encoded protein has a 3′-5′ RNase activity and prefers polyadenylated substates.

Sequence

Synthetic peptide located within the following region: EISGKVRSLSASLWSLTHLTALHLSDNSLSRIPSDIAKLHNLVYLDLSSN

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 12 - Non Combustible Liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable