Synthetic peptide directed towards the C terminal region of human GLIS3
Biochem/physiol Actions
GLIS3 is a member of the GLI-similar zinc finger protein family and has five C2H2-type zinc finger domains. GLIS3 functions as both a repressor and activator of transcription and is specifically involved in the development of pancreatic beta cells, the thyroid, eye, liver and kidney. Mutations in this gene have been associated with neonatal diabetes and congenital hypothyroidism (NDH).
Sequence
Synthetic peptide located within the following region: QASFDVFHRAFSTHSGITVYDLPSSSSSLFGESLRSGAEDATFLQISTVD
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.