tRNA methyltransferase 6 (TRMT6), also known as GCD10 (General control non-derepressible protein 10), is a 54.6 kDa protein. The gene is located on human chromosome 20p12.3.
Immunogen
Synthetic peptide directed towards the middle region of human TRMT6
Biochem/physiol Actions
tRNA methyltransferase 6 (TRMT6), also known as GCD10 (General control non-derepressible protein 10), is essential for initiating protein synthesis. TRMT6 encoded polypeptide is required for cell viability and consists of a sequence related to the RNA-recognition motif, which is found in many RNA-binding proteins. It helps in DNA methylation. Mutations in TRMT6 along with other genes might be linked to tumorigenesis. It acts as a translational repressor of (general control protein) GCN4.
Sequence
Synthetic peptide located within the following region: GAMMERMGGFGSIIQLYPGGGPVRAATACFGFPKSFLSGLYEFPLNKVDS
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
tRNA is a central component of protein synthesis and the cell signaling network. One salient feature of tRNA is its heavily modified status, which can critically impact its function. Here, we show that mammalian ALKBH1 is a tRNA demethylase. It mediates
Genome-wide association studies identify loci associated with age at menarche and age at natural menopause
He C et al.
Nature Genetics, 41(6), 724-724 (2009)
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.