Synthetic peptide directed towards the N terminal of human DCAF7
Biochem/physiol Actions
Dcaf7 is involved in craniofacial development. It acts upstream of the EDN1 pathway and is required for formation of the upper jaw equivalent, the palatoquadrate. The activity required for EDN1 pathway function differs between the first and second arches. It associates with DIAPH1 and controls GLI1 transcriptional activity. It could be involved in skin development. It may function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex.
Sequence
Synthetic peptide located within the following region: SLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVG
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
