Synthetic peptide directed towards the N terminal region of human TM7SF4
Biochem/physiol Actions
Dendritic cells are unique in their ability to present antigen to naive T cells, and therefore play a central role in the initiation of immune responses. The protein encoded by this gene is a transmembrane molecule that is preferentially expressed by dendritic cells. Its expression is down-regulated by ligation of the CD40 molecule. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.
Sequence
Synthetic peptide located within the following region: AGTGIVILGHVENIFHNFKGLLDGMTCNLRAKSFSIHFPLLKKYIEAIQW
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
