Synthetic peptide directed towards the C terminal of human B4GALT6
Biochem/physiol Actions
B4galt6 is required for the biosynthesis of glycosphingolipids.
Sequence
Synthetic peptide located within the following region: GGEDDDLWNRVHYAGYNVTRPEGDLGKYISIPHHHRGEVQFLGRYKLLRY
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Biochimica et biophysica acta. Molecular and cell biology of lipids, 1864(8), 1157-1167 (2019-05-06)
Natural killer T (NKT) cells in adipose tissue (AT) contribute to whole body energy homeostasis. Inhibition of the glucosylceramide synthesis in adipocytes impairs iNKT cell activity. Glucosylceramide biosynthesis pathway is important for endogenous lipid antigen activation of iNKT cells in
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.