SAB2106581

Anti-ENDOU antibody produced in rabbit

affinity isolated antibody

• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 45 kDa
• species reactivity: human, mouse, rat
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NM_001168693
• UniProt accession no.: Q3V188
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ENDOU(8909) ; mouse ... Endou(19011)

Description

Immunogen

The immunogen for anti-ENDOU antibody: synthetic peptide derected towards the middle region of human ENDOU

Biochem/physiol Actions

Endou is an endoribonuclease that cleaves single-stranded RNAs at uridylates and releases products that have 2′-3′-cyclic phosphate termini.

Sequence

Synthetic peptide located within the following region: VDRSPEPLFTYVNEKLFSKPTYAAFINLLNNYQRATGHGEHFSAQQLEEQ

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 12 - Non Combustible Liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable