SAB2105544
Anti-SLC2A8 antibody produced in rabbit
affinity isolated antibody
Synonym(s):
Anti-GLUT8, Anti-GLUTX1
Sign Into View Organizational & Contract Pricing
Select a Size
100 μL
$541.00
$541.00
Usually ships in 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)
All Photos(3)
Select a Size
Change View
100 μL
$541.00
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
$541.00
Usually ships in 5 business days. (Orders outside of US, please allow an additional 1-2 weeks for delivery)
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
51 kDa
species reactivity
rabbit, human
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... SLC2A8(29988)
General description
Solute carrier family 2 member 8 (SLC2A8)/Glucose transporter 8 (GLUT8), a class III sugar transporter, is expressed in the testis and brain. In the brain, GLUT8 is expressed mainly in the cerebral cortex, hippocampus, amygdala, and hypothalamus.
Immunogen
Synthetic peptide directed towards the middle region of human SLC2A8
Biochem/physiol Actions
Solute carrier family 2 member 8 (SLC2A8)/glucose transporter 8 (GLUT8) plays a key role in modulating the transport of fructose and the utilization of mammalian fructose. It is a trehalose transporter found in mammals that is necessary for trehalose-induced autophagy. SLC2A8 can also transport intracellular hexose. Hence, it might serve as a multifunctional sugar transporter.
Sequence
Synthetic peptide located within the following region: VLSGVVMVFSTSAFGAYFKLTQGGPGNSSHVAISAPVSAQPVDASVGLAW
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk_germany
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Lot/Batch Number
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Masato Mashima et al.
Neuroscience letters, 636, 90-94 (2016-11-08)
Glucose transporter 8 (GLUT8), a glucose/fructose transporter, has been shown to be expressed in neuronal cells in several brain areas. A recent immunohistochemical study has shown the presence of GLUT8 in the cytoplasm of epithelial cells of the choroid plexus
Allyson L Mayer et al.
Scientific reports, 6, 38586-38586 (2016-12-07)
Trehalose is a disaccharide demonstrated to mitigate disease burden in multiple murine neurodegenerative models. We recently revealed that trehalose rapidly induces hepatic autophagy and abrogates hepatic steatosis by inhibiting hexose transport via the SLC2A family of facilitative transporters. Prior studies
Stefan Schmidt et al.
American journal of physiology. Endocrinology and metabolism, 296(4), E614-E618 (2009-01-30)
GLUT8 is a class III sugar transporter predominantly expressed in testis and brain. In contrast to the class I and class II transporters, hydrophobicity plots predict a short extracellular loop between transmembrane domain (TM)1 and TM2 and a long extracellular
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service
