SAB2105298

Anti-EOMES, (C-terminal) antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-C77258, Anti-Tbr2
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 75 kDa
• species reactivity: human, mouse
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunohistochemistry: suitable; western blot: suitable
• NCBI accession no.: NM_010136
• UniProt accession no.: O54839
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... EOMES(8320) ; mouse ... Eomes(13813)

Description

Immunogen

Synthetic peptide directed towards the C terminal region of human Eomes

Biochem/physiol Actions

Eomes functions as a transcriptional activator playing a crucial role during development. Eomes functions in trophoblast differentiation and later in gastrulation, regulating both mesoderm delamination and endoderm specification.Eomes plays a role in brain development being required for the specification and the proliferation of the intermediate progenitor cells and their progeny in the cerebral cortex. Eomes also involved in the differentiation of CD8+ T-cells during immune response regulating the expression of lytic effector genes.

Sequence

Synthetic peptide located within the following region: SSDSGVYNSACKRKRLSPSTPSNGNSPPIKCEDINTEEYSKDTSKGMGAY

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 12 - Non Combustible Liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable