Synthetic peptide directed towards the middle region of human EBF2
Biochem/physiol Actions
EBF2 belongs to the conserved Olf/EBF family of helix-loop-helix transcription factors.EBF2 belongs to the conserved Olf/EBF family (see MIM 164343) of helix-loop-helix transcription factors (Wang et al., 2002 [PubMed 12139918]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-103 AU120738.1 302-404 104-650 AL701879.1 1-547 651-735 AC090103.4 79460-79544 736-796 BC069665.1 1-61 797-1794 BC074794.2 1-998 1795-2297 AK021562.1 1082-1584
Sequence
Synthetic peptide located within the following region: GDPERLAKEMLLKRAADLVEALYGTPHNNQDIILKRAADIAEALYSVPRN
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.