AKT interacting protein (AKTIP) is the member of the ubiquitin E2 variant (UEV) enzyme subfamily. It is a sheltering interacting protein. AKTIP gene is located on human chromosome 16q12.2. The protein is homologous E2 variant ubiquitin-conjugating (UEV) enzymes.
Immunogen
Synthetic peptide directed towards the middle region of human AKTIP
Biochem/physiol Actions
AKT interacting protein (AKTIP) is essential for the replication of telomeric DNA. AKTIP plays an important role in lamin related processes, such as maintaining nuclear architecture, telomere homeostasis and cellular senescence It interacts with Akt (non-specific serine/threonine protein kinase) activity and regulates differentiation, proliferation and apoptosis of many cell types. AKTIP helps in regulating radiation cytotoxicity in cervical cancer. It is involved in vesicle trafficking.
Sequence
Synthetic peptide located within the following region: NPSVHDEAREKMLTQKKPEEQHNKSVHVAGLSWVKPGSVQPFSKEEKTVA
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
The role of Fused Toes Homolog (FTS) in epidermal growth factor (EGF) induced epithelial-mesenchymal transition (EMT) in cervical cancer cells was studied. EGF treatment induced the change of EMT markers and increased cell migration. EGF treatment also increased phosphorylated EGFR
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
