SAB2103492

Anti-LASS5, (N-terminal) antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-CerS5, Anti-FLJ25304, Anti-MGC45411, Anti-Trh4
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 46 kDa
• species reactivity: bovine, human, rabbit
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NM_147190
• UniProt accession no.: Q8N5B7
• shipped in: wet ice
• storage temp.: −20°C
• Gene Information: human ... LASS5(91012)

Description

Immunogen

Synthetic peptide directed towards the N terminal region of human LASS5

Biochem/physiol Actions

LASS5 may be either a bona fide (dihydro)ceramide synthase or a modulator of its activity. When it is overexpressed in cells it is involved in the production of sphingolipids containing mainly only one fatty acid donor (N-linked palmitoyl- (C16) ceramide) in a fumonisin B1-independent manner.

Sequence

Synthetic peptide located within the following region: PCALCIGIEDSGPYQAQPNAILEKVFISITKYPDKKRLEGLSKQLDWNVR

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 12 - Non Combustible Liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable