Skip to Content
MilliporeSigma
All Photos(1)

Key Documents

SAB2103443

Sigma-Aldrich

Anti-CSRP1 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-CRP, Anti-CRP1, Anti-CSRP, Anti-CYRP, Anti-D1S181E

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

20 kDa

species reactivity

rat, human, dog, guinea pig, rabbit, mouse

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CSRP1(1465)

General description

Cysteine and glycine rich protein 1 (CSRP1) is expressed in smooth muscles. The gene is located on human chromosome 1q32.1.

Immunogen

Synthetic peptide directed towards the middle region of human CSRP1

Biochem/physiol Actions

Cysteine and glycine rich protein 1 (CSRP1) is a member of the cysteine-rich protein (CSRP) family. This gene family includes a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this gene product occurs in proteins with critical functions in gene regulation, cell growth, and somatic differentiation. Other genes in the family include CSRP2 and CSRP3. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
LIM domain of CSRP1 is involved in smooth muscle differentiation and protein dimerization. CSRP1 modulates actin filament bundling. It acts as a stress response factor and is involved in growth inhibitory and cytoprotective functions.

Sequence

Synthetic peptide located within the following region: YGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCP

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

12 - Non Combustible Liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Cytoskeleton-interacting LIM-domain protein CRP1 suppresses cell proliferation and protects from stress-induced cell death
Latonen L, et al.
Experimental Cell Research, 314(4), 738-747 (2008)
The LIM/double zinc-finger motif functions as a protein dimerization domain
Feuerstein R, et al.
Proceedings of the National Academy of Sciences of the USA, 91(22), 10655-10659 (1994)
Päivi M Järvinen et al.
Journal of cellular physiology, 227(6), 2605-2612 (2011-09-02)
Transforming growth factor-β (TGF-β) is a diverse cytokine regulating growth, apoptosis, differentiation, adhesion, invasion, and extracellular matrix production. Dysregulation of TGF-β is associated with fibrotic disorders and epithelial-mesenchymal transition, and has been linked with idiopathic pulmonary fibrosis (IPF). Cysteine-rich protein
Epigenetics Offer New Horizons for Colorectal Cancer Prevention.
Schnekenburger M and Diederich M
Current Colorectal Cancer Reports, 8(1), 66-81 (2012)

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service