Synthetic peptide directed towards the N terminal region of human USP18
Biochem/physiol Actions
USP18, a member of the deubiquitinating protease family of enzymes, removes ubiquitin adducts from a broad range of protein substrates.USP18, a member of the deubiquitinating protease family of enzymes, removes ubiquitin adducts from a broad range of protein substrates.[supplied by OMIM]. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-232 AC008079.24 80964-81195 233-495 AC008079.24 88531-88793 496-592 AC008079.24 91145-91241 593-738 AC008079.24 92763-92908 739-818 AC008079.24 98228-98307 819-965 AC008079.24 98863-99009 966-1061 AC008079.24 100817-100912 1062-1229 AC008079.24 101726-101893 1230-1361 AC008079.24 104123-104254 1362-1411 AC008079.24 104766-104815 1412-2037 AC008079.24 107745-108370
Sequence
Synthetic peptide located within the following region: MQDSRQKAVRPLELAYCLQKCNVPLFVQHDAAQLYLKLWNLIKDQITDVH
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.