The previously assigned protein identifier Q6IN77 has been merged into O14787. Full details can be found on the UniProt database.
Immunogen
Synthetic peptide directed towards the N terminal region of human TNPO2
Biochem/physiol Actions
Transportin-2 (TNPO2) mediates nuclear import of HuR protein in vitro. It also participates in mRNA export from the nucleus.
Sequence
Synthetic peptide located within the following region: MDWQPDEQGLQQVLQLLKDSQSPNTATQRIVQDKLKQLNQFPDFNNYLIF
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.