Transmembrane serine protease 11D (TMPRSS11D) also known as human airway trypsin or HAT encodes a trypsin-like serine protease released from the submucosal serous glands onto mucous membrane. TMPRSS11D is expressed predominantly in the respiratory tract. It is a type II integral membrane protein and has 29-38% identity in the sequence of the catalytic region with human hepsin, enteropeptidase, acrosin, and mast cell tryptase. The noncatalytic region has little similarity to other known proteins. In human chromosome, the gene TMPRSS11D is located on 4q13.2.
Immunogen
Synthetic peptide directed towards the middle region of human TMPRSS11D
Biochem/physiol Actions
Transmembrane serine protease 11D (TMPRSS11D) protein may play some biological role in the host defence system on the mucous membrane independently of or in cooperation with other substances in airway mucous or bronchial secretions. TMPRSS11D known to facilitate the entry of influenza viruses. TMPRSS11D is a common active proteolytic enzymes in lower female reproductive tract. TMPRSS11D expression is a key marker for squamous cell carcinogenesis and non-small cell lung cancer (NSCLC).
Sequence
Synthetic peptide located within the following region: IHSVCLPAATQNIPPGSTAYVTGWGAQEYAGHTVPELRQGQVRIISNDVC
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Proteolytic activation of influenza viruses by serine proteases TMPRSS2 and HAT from human airway epithelium
Bottcher E, et al.
Journal of Virology, 80(19), 9896-9898 (2006)
Cloning and characterization of the cDNA for human airway trypsin-like protease
Yamaoka K, et al.
The Journal of Biological Chemistry, 273(19), 11895-11901 (1998)
Prenatal diagnosis and molecular cytogenetic characterization of concomitant familial small supernumerary marker chromosome derived from chromosome 4q (4q11. 1-q13. 2) and 5q13. 2 microdeletion with no apparent phenotypic abnormality
Chen CP, et al.
Taiwanese Journal of Obstetrics & Gynecology, 56(2), 217-223 (2017)
Functional proteomic profiling reveals KLK13 and TMPRSS11D as active proteases in the lower female reproductive tract
Muytjens CMJ, et al.
F1000Research, 7, 1666-1666 (2018)
High TMPRSS11D protein expression predicts poor overall survival in non-small cell lung cancer
Cao X, et al.
Oncotarget, 8(8), 12812-12812 (2017)
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
