SAB2102171

Anti-SLC1A2 antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-EAAT2, Anti-GLT-1, Anti-Solute carrier family 1 (glial high affinity glutamate transporter), member 2
• MDL number: MFCD01092543
• UNSPSC Code: 12352203

Properties

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: lyophilized powder
• mol wt: 62 kDa
• species reactivity: rabbit, canine, zebrafish, rat, horse, mouse, guinea pig, human, sheep
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• UniProt accession no.: P43004
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SLC1A2(6506)

Description

Immunogen

The immunogen for anti-SLC1A2 antibody: synthetic peptide derected towards the N terminal of human SLC1A2

Sequence

Synthetic peptide located within the following region: PGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTK

Physical form

Lyophilized from PBS buffer with 2% sucrose

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 12 - Non Combustible Liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable