SAB2102084

Anti-SCGN (ab1) antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-CALBL, Anti-DJ501N12.8, Anti-SECRET, Anti-SEGN, Anti-Secretagogin, EF-hand calcium binding protein
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 32 kDa
• species reactivity: guinea pig, rat, horse, rabbit, dog, mouse, human, bovine
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• UniProt accession no.: O76038
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SCGN(10590)

Description

Immunogen

Synthetic peptide directed towards the middle region of human SCGN

Biochem/physiol Actions

SCGN is a secreted calcium-binding protein which is found in the cytoplasm. It is related to calbindin D-28K and calretinin. This protein is thought to be involved in KCL-stimulated calcium flux and cell proliferation.The encoded protein is a secreted calcium-binding protein which is found in the cytoplasm. It is related to calbindin D-28K and calretinin. This protein is thought to be involved in KCL-stimulated calcium flux and cell proliferation.

Sequence

Synthetic peptide located within the following region: KDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable