Synthetic peptide directed towards the N terminal region of human PLA2G4B
Biochem/physiol Actions
PLA2G4B gene transcribes naturally-occurring mRNAs that are co-transcribed products of the neighboring JMJD7 and PLA2G4B genes. Incompletely processed read-through transcripts from these two loci are abundantly expressed in most tissues, but Alternative splicing of this gene results in different transcript variants, some of which are candidates for nonsense-mediated decay (NMD).The LOC100137047-PLA2G4B mRNAs are naturally occurring co-transcribed products of the neighboring LOC100137047 and PLA2G4B genes. Incompletely processed read-through transcripts from these two loci are abundantly expressed in most tissues, but Alternative splicing of this gene results in different transcript variants, some of which are candidates for nonsense-mediated decay (NMD).
Sequence
Synthetic peptide located within the following region: AEAALEAVRSELREFPAAARELCVPLAVPYLDKPPTPLHFYRDWVCPNRP
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
