SAB2100685

Anti-ENTPD8 antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-Ectonucleoside triphosphate diphosphohydrolase 8, Anti-GLSR2492, Anti-NTPDase-8, Anti-UNQ2492
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 54 kDa
• species reactivity: human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• UniProt accession no.: Q5MY95
• shipped in: wet ice
• Storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ENTPD8(377841)

Description

Immunogen

Synthetic peptide directed towards the N terminal region of human ENTPD8

Biochem/physiol Actions

ENTPD8 is the canalicular ectonucleoside NTPDase responsible for the main hepatic NTPDase activity. Ectonucleoside NTPDases catalyze the hydrolyzis of gamma- and beta-phosphate residues of nucleotides, playing a central role in concentration of extracellular nucleotides. It has activity toward ATP, ADP, UTP and UDP, but not toward AMP.

Sequence

Synthetic peptide located within the following region: IPEAQHRKTPTFLGATAGMRLLSRKNSSQARDIFAAVTQVLGRSPVDFWG

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 12 - Non Combustible Liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable