Caveolin 2 (CAV2) gene with three exons is mapped to human chromosome 7q31. The encoded protein is expressed in variety of human tissues, including the scleral spur cells, trabecular meshwork and retinal ganglion cells of the eye.
Immunogen
Synthetic peptide directed towards the N terminal region of human CAV2
Biochem/physiol Actions
Caveolin 2 (CAV2) along with CAV1, participates in transcytosis by inducing the formation of specialized invaginations of the plasma membrane called caveolae. CAV2 might be involved in the process of hormonal translocation. It is also implicated in the regulation of cancer progression. CAV2 plays an essential role in the regulation of sex hormone 17β-estradiol (E2)-dependent cellular proliferation. Genetic variation in the gene is associated with the increased risk of developing primary open-angle glaucoma (POAG).
Sequence
Synthetic peptide located within the following region: LVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSE
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
