SAB2100217

Anti-BHLHB3 antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-Basic helix-loop-helix domain containing, class B, 3, Anti-SHARP1
• MDL number: MFCD03097265
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 50 kDa
• species reactivity: human, pig, dog
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• UniProt accession no.: Q9C0J9
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... BHLHB3(79365)

Description

Immunogen

Synthetic peptide directed towards the middle region of human BHLHB3

Biochem/physiol Actions

BHLHB3 may be a transcriptional repressor that represses both basal and activated transcription. It play a role as a tumor suppressor for lung cancer. DEC1 and DEC2(BHLHB3) may play a crucial role in the adaptation to hypoxia and are regulators of the mammalian molecular clock, and form a fifth clock-gene family.

Sequence

Synthetic peptide located within the following region: YCVPVIQRTQPSAELAAENDTDTDSGYGGEAEARPDREKGKGAGASRVTI

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable