Skip to Content
MilliporeSigma
All Photos(4)

Key Documents

SAB2100037

Sigma-Aldrich

Anti-ACTB antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-β-Actin, Anti-PS1TP5BP1

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

lyophilized powder

mol wt

42 kDa

species reactivity

goat, horse, Caenorhabditis elegans, rat, pig, sheep, bovine, mouse, human, zebrafish

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

UniProt accession no.

Storage temp.

−20°C

Gene Information

human ... ACTB(60)

Immunogen

The immunogen for anti-ACTB antibody: synthetic peptide derected towards the middle region of human ACTB

Sequence

Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK

Physical form

Lyophilized from PBS buffer with 2% sucrose

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

12 - Non Combustible Liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Yongjun Zhang et al.
Experimental and therapeutic medicine, 16(4), 2931-2937 (2018-09-15)
Gastric cancer is the third leading cause of cancer-associated deaths worldwide. Research into the underlying mechanisms of gastric cancer is essential for the development of novel therapeutic agents to improve the prognoses of patients with gastric cancer. Tanshinone IIA (Tan
Dongmei Han et al.
Molecular medicine reports, 11(4), 2896-2902 (2014-12-09)
A pharmaceutical composition (patent no. WO2012079419) exhibited favorable outcomes in a clinical trial of wet age‑related macular degeneration. The aims of the present study were to explore the effects of one composition component, charred Radix et Rhizoma Rhei (CRRR), in
Yosuke Inoue et al.
The Journal of comparative neurology, 530(11), 2033-2055 (2022-04-04)
The structural plasticity of dendritic spines serves as the adaptive capabilities of the central nervous system to various stimuli. Among these stimuli, cerebral ischemia induces dynamic alterations in neuronal network activity. Arcadlin/Paraxial protocadherin/Protocadherin-8 (Acad), a regulator of dendritic spine density
Yingshan Liu et al.
Experimental and therapeutic medicine, 9(4), 1401-1406 (2015-03-18)
The ability of metformin, an antidiabetic drug with wide applications, to inhibit tumor cell growth has recently been discovered. The PI3K/Akt signaling pathway has been found to play an important role in the survival, proliferation and apoptosis of tumor cells.
Hassina Massudi et al.
Cancers, 15(6) (2023-03-30)
MYCN is a major oncogenic driver for neuroblastoma tumorigenesis, yet there are no direct MYCN inhibitors. We have previously identified PA2G4 as a direct protein-binding partner of MYCN and drive neuroblastoma tumorigenesis. A small molecule known to bind PA2G4, WS6

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service