SAB1412669
ANTI-MCM3 antibody produced in mouse
clone 2H3, purified immunoglobulin, buffered aqueous solution
Synonym(s):
HCC5, MCM3, MGC1157, P1-MCM3, P1.h
Sign Into View Organizational & Contract Pricing
All Photos(6)
About This Item
UNSPSC Code:
12352203
biological source
mouse
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
2H3, monoclonal
form
buffered aqueous solution
mol wt
antigen 37.84 kDa
species reactivity
human
technique(s)
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL
isotype
IgG2aκ
NCBI accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... MCM3(4172)
General description
Minichromosome maintenance complex component 3 (MCM3) is encoded by the gene mapped to human chromosome 6p12.2-p12.1. The encoded protein is a member of MCM protein family.
The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with, and thus is acetlyated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression. (provided by RefSeq)
Immunogen
MCM3 (NP_002379, 699 a.a. ~ 808 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AKDGDSYDPYDFSDTEEEMPQVHTPKTADSQETKESQKVELSESRLKAFKVALLDVFREAHAQSIGMNRLTESINRDSEEPFSSVEIQAALSKMQDDNQVMVSEGIIFLI
Sequence
AKDGDSYDPYDFSDTEEEMPQVHTPKTADSQETKESQKVELSESRLKAFKVALLDVFREAHAQSIGMNRLTESINRDSEEPFSSVEIQAALSKMQDDNQVMVSEGIIFLI
Biochem/physiol Actions
Minichromosome maintenance complex component 3 (MCM3) is a mini-chromosome maintenance protein in eukaryotic genome replication. MCM proteins are key components of the pre-replication complex, recruit replication-related proteins and form replication forks. The PS1 putative hairpin of MCM3 is specifically required for DNA unwinding and viability. MCM3 is a marker for tumorigenesis in several human cancers. Aberration in the expression of MCM3 is associated with the development of papillary thyroid carcinoma (PTC).
Physical form
Solution in phosphate buffered saline, pH 7.4
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
12 - Non Combustible Liquids
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Lot/Batch Number
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
The PS1 hairpin of Mcm3 is essential for viability and for DNA unwinding in vitro.
Lam SK
PLoS ONE, 8(12), 1-15 (2013)
MCM3 protein expression in follicular and classical variants of papillary thyroid carcinoma.
Igci YZ
Pathology Oncology Research, 20(1), 87-91 (2014)
Three de novo losses and one insertion within a pericentric inversion of chromosome 6 in a patient with complete absence of expressive speech and reduced pain perception.
Poot M
European Journal of Medical Genetics, 52(1), 27-30 (2009)
Karen M Knapp et al.
European journal of human genetics : EJHG, 29(7), 1110-1120 (2021-03-04)
The MCM2-7 helicase is a heterohexameric complex with essential roles as part of both the pre-replication and pre-initiation complexes in the early stages of DNA replication. Meier-Gorlin syndrome, a rare primordial dwarfism, is strongly associated with disruption to the pre-replication
Seon-Ah Ha et al.
Clinical cancer research : an official journal of the American Association for Cancer Research, 10(24), 8386-8395 (2004-12-30)
The purpose of our study was to identify an unique gene that shows cancer-associated expression, evaluates its potential usefulness in cancer diagnosis, and characterizes its function related to human carcinogenesis. We used the differential display reverse transcription-PCR method with normal
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service