Skip to Content
MilliporeSigma
All Photos(4)

Key Documents

SAB1412396

Sigma-Aldrich

ANTI-ZNF207 antibody produced in mouse

clone 8G7, purified immunoglobulin, buffered aqueous solution

Synonym(s):

BuGZ, hBuGZ, DKFZp761N202, ZNF207

Sign Into View Organizational & Contract Pricing

Select a Size

100 μG
$541.00

$541.00


Ships within 2 weeks. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)


Select a Size

Change View
100 μG
$541.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

$541.00


Ships within 2 weeks. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

8G7, monoclonal

form

buffered aqueous solution

mol wt

antigen 37.84 kDa

species reactivity

human

technique(s)

indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ZNF207(7756)

General description

Zinc finger protein 207 (ZNF207) consists of a N-terminal zinc finger domain and a conserved GLE-2-binding sequence (GLEBS) motif, which helps BUB3 (budding uninhibited by benzimidazoles 3) binding. The gene is located on human chromosome 17q11.2.

Immunogen

ZNF207 (NP_003448, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MGRKKKKQLKPWCWYCNRDFDDEKILIQHQKAKHFKCHICHKKLYTGPGLAIHCMQVHKETIDAVPNAIPGRTDIELEIYGMEGIPEKDMDERRRLLEQKTQESQKKKQQ

Biochem/physiol Actions

Zinc finger protein 207 (ZNF207) maintains BUB3 (budding uninhibited by benzimidazoles 3) protein stability and chromosome congression. This protein interacts with microtubules and maintains chromosome alignment. It also helps in the loading of Bub3 protein to the kinetochores. ZNF207 is essential for maintaining the viability of glioblastoma stem cells.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

BuGZ is required for Bub3 stability, Bub1 kinetochore function, and chromosome alignment
Toledo CM, et al.
Developmental Cell, 28(3), 282-294 (2014)
A protective chaperone for the kinetochore adaptor Bub3
Ji Z and Yu H
Developmental Cell, 28(3), 223-224 (2014)
Identification of genes associated with tumorigenesis of retinoblastoma by microarray analysis
Chakraborty S, et al.
Genomics, 90(3), 344-353 (2007)
Hao Jiang et al.
Developmental cell, 28(3), 268-281 (2014-01-28)
Equal chromosome segregation requires proper assembly of many proteins, including Bub3, onto kinetochores to promote kinetochore-microtubule interactions. By screening for mitotic regulators in the spindle envelope and matrix (Spemix), we identify a conserved Bub3 interacting and GLE-2-binding sequence (GLEBS) containing
Conserved transcription factors promote cell fate stability and restrict reprogramming potential in differentiated cells.
Missinato, et al.
Nature Communications, 14, 1709-1709 (2023)

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service