SAB1412069

ANTI-CXCL12 antibody produced in mouse

clone 2E2, purified immunoglobulin, buffered aqueous solution

• Synonym(s): CXCL12, PBSF, SCYB12, SDF-1a, SDF-1b
• UNSPSC Code: 12352203

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 2E2, monoclonal
• form: buffered aqueous solution
• mol wt: antigen 35.53 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable
• isotype: IgG2bκ
• NCBI accession no.: BC039893
• UniProt accession no.: P48061
• shipped in: dry ice
• Storage temp.: −20°C
• Gene Information: human ... CXCL12(6387)

Description

General description

C-X-C motif chemokine ligand 12 (CXCL12), also known as stromal cell-derived factor 1 α (SDF-1α), is encoded by the gene mapped to human chromosome 10q11. Stromal cell-derived factor 1 α and ß (SDF-1 α and ß) are stromal derived CXC chemokines and signal through the C-X-C motif chemokine receptor-4 (CXCR4). CXCL12 is mainly expressed in the inflamed and failing myocardium.

For background information on chemokines, see CXCL1 (MIM 155730). Stromal cell-derived factors 1-alpha and 1-beta are small cytokines that belong to the intercrine family, members of which activate leukocytes and are often induced by proinflammatory stimuli such as lipopolysaccharide, TNF (see MIM 191160), or IL1 (see MIM 147760). The intercrines are characterized by the presence of 4 conserved cysteines which form 2 disulfide bonds. They can be classified into 2 subfamilies. In the CC subfamily, which includes beta chemokine, the cysteine residues are adjacent to each other. In the CXC subfamily, which includes alpha chemokine, they are separated by an intervening amino acid. The SDF1 proteins belong to the latter group.[supplied by OMIM

Immunogen

CXCL12 (AAH39893.1, 1 a.a. ~ 89 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK

Biochem/physiol Actions

C-X-C motif chemokine ligand 12 (CXCL12) is involved in inflammation, proliferation, tumorigenicity and metastasis. CXCL12 exerts HIV (human immunodeficiency virus) suppressive activity in cells expressing the CXCR4 (C-X-C motif chemokine receptor 4). It is overexpressed in breast carcinoma, ovarian carcinoma and papillary thyroid carcinoma. It enhances angiogenesis in the ischemic tissue. SDF1 is also implicated in neuroprotection after ischemic stroke with the help of CXCR4.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 12 - Non Combustible Liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable