Skip to Content
MilliporeSigma
All Photos(2)

Key Documents

SAB1411032

Sigma-Aldrich

Anti-THAP1 antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

Synonym(s):

FLJ10477, MGC33014

Sign Into View Organizational & Contract Pricing

Select a Size

100 μG
$541.00

$541.00


Ships within 2 weeks. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)

Notify Me

Get notified when this item is ready to ship via email.


Select a Size

Change View
100 μG
$541.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

$541.00


Ships within 2 weeks. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)

Notify Me

Get notified when this item is ready to ship via email.

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

antigen 24.9 kDa

species reactivity

human

technique(s)

western blot: 1 μg/mL

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... THAP1(55145)

General description

THAP domain containing 1 (THAP1) is a transcription factor encoded by the gene mapped to human chromosome 18p11.21. The encoded protein contains an N-terminal conserved DNA-binding domain, designated THAP domain with a zinc-finger structure.
The protein encoded by this gene contains a THAP domain, a conserved DNA-binding domain. This protein colocalizes with the apoptosis response protein PAWR/PAR-4 in promyelocytic leukemia (PML) nuclear bodies, and functions as a proapoptotic factor that links PAWR to PML nuclear bodies. Alternatively spliced transcript variants encoding distinct isoforms have been observed. (provided by RefSeq)

Immunogen

THAP1 (NP_060575.1, 1 a.a. ~ 213 a.a) full-length human protein.

Sequence
MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKEWEAAVRRKNFKPTKYSSICSEHFTPDCFKRECNNKLLKENAVPTIFLCTEPHDKKEDLLEPQEQLPPPPLPPPVSQVDAAIGLLMPPLQTPVNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKLKEVVHFQKEKDDVSERGYVILPNDYFEIVEVPA

Biochem/physiol Actions

THAP domain containing 1 (THAP1) plays a key role in endothelial cell proliferation and pro-apoptotic processes. Mutation in the gene is associated with primary dystonia type 6 (DYT6). The encoded protein links prostate-apoptosis-response-4 (Par-4) to promyelocytic leukemia (PML) nuclear bodies, which facilitates both serum withdrawal and tumor necrosis factor-α (TNFα)-induced apoptosis.

Physical form

Solution in phosphate buffered saline, pH 7.4

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documents section.

If you need assistance, please contact Customer Support

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Myriam Roussigne et al.
Oncogene, 22(16), 2432-2442 (2003-04-30)
Promyelocytic leukemia (PML) nuclear bodies (PML NBs) are discrete subnuclear domains organized by the promyelocytic leukemia protein PML, a tumor suppressor essential for multiple apoptotic pathways. We have recently described a novel family of cellular factors, the THAP proteins, characterized
Marta Jurek et al.
Neurologia i neurochirurgia polska, 48(4), 254-257 (2014-08-30)
Mutations localized in THAP1 gene, locus 18p11.21 have been reported as causative of primary dystonia type 6 (DYT6). Disease which is characterized mainly by focal dystonia, frequently involving the craniocervical region, however associated also with early-onset generalized dystonia and spasmodic
Ewa Golanska et al.
PloS one, 10(6), e0129656-e0129656 (2015-06-19)
The aim of this study was to assess the presence of DYT6 mutations in Polish patients with isolated dystonia and to characterize their phenotype. We sequenced THAP1 exons 1, 2 and 3 including exon-intron boundaries and 5'UTR fragment in 96

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service