SAB1409440

Anti-CFP antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

• Synonym(s): BFD, PFC, PFD, PROPERDIN
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: antigen 51.3 kDa
• species reactivity: human
• technique(s): western blot: 1 μg/mL
• NCBI accession no.: NM_002621
• UniProt accession no.: P27918
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... CFP(5199)

Description

General description

Complement factor properdin (CFP) gene is located on human chromosome Xp11.23. CFP is released by proinflammatory activated leukocytes, which interacts with activated platelets. CFP is also produced by T cells and bone marrow progenitor cell line. Plasma properdin is released by endothelial cells, when induced by shear stress. CFP consists of 442 amino acids.

Immunogen

CFP (NP_002612.1, 1 a.a. ~ 469 a.a) full-length human protein.

Sequence
MITEGAQAPRLLLPPLLLLLTLPATGSDPVLCFTQYEESSGKCKGLLGGGVSVEDCCLNTAFAYQKRSGGLCQPCRSPRWSLWSTWAPCSVTCSEGSQLRYRRCVGWNGQCSGKVAPGTLEWQLQACEDQQCCPEMGGWSGWGPWEPCSVTCSKGTRTRRRACNHPAPKCGGHCPGQAQESEACDTQQVCPTHGAWATWGPWTPCSASCHGGPHEPKETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLPPCPVAGGWGPWGPVSPCPVTCGLGQTMEQRTCNHPVPQHGGPFCAGDATRTHICNTAVPCPVDGEWDSWGEWSPCIRRNMKSISCQEIPGQQSRGRTCRGRKFDGHRCAGQQQDIRHCYSIQHCPLKGSWSEWSTWGLCMPPCGPNPTRARQRLCTPLLPKYPPTVSMVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEEL

Biochem/physiol Actions

Complement factor properdin (CFP) helps in energy and lipid metabolism. It regulates the uptake of fatty acid into adipose tissue. CFP upregulates the alternative pathway by stabilizing the C3 convertase (C3bBb) complex. Deficiency of properdin might be associated with immune complex-induced arthritis.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 12 - Non Combustible Liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable