SAB1406539

Anti-TMSB4X antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

• Synonym(s): FX, PTMB4, TB4X, TMSB4
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: antigen ~4.84 kDa
• species reactivity: human
• technique(s): indirect immunofluorescence: suitable; western blot: 1 μg/mL
• NCBI accession no.: BC001631
• UniProt accession no.: P62328
• shipped in: dry ice
• storage temp.: −20°C
• Gene Information: human ... TMSB4X(7114)

Description

General description

This gene encodes an actin sequestering protein which plays a role in regulation of actin polymerization. The protein is also involved in cell proliferation, migration, and differentiation. This gene escapes X inactivation and has a homolog on chromosome Y. (provided by RefSeq)

Immunogen

TMSB4X (AAH01631.1, 1 a.a. ~ 44 a.a) full-length human protein.

Sequence
MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 13 - Non Combustible Solids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable