SAB1404947

Monoclonal Anti-DAAM1, (N-terminal) antibody produced in mouse

clone 4H3, purified immunoglobulin, buffered aqueous solution

• Synonym(s): FLJ41657, KIAA0666
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 4H3, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~38.21 kDa
• species reactivity: rat, human
• technique(s): capture ELISA: suitable; indirect ELISA: suitable; proximity ligation assay: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• NCBI accession no.: NM_014992
• UniProt accession no.: Q9Y4D1
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... DAAM1(23002)

Description

General description

Functions of the cell cortex, including motility, adhesion, and cytokinesis, are mediated by the reorganization of the actin cytoskeleton and recent evidence suggests a role for the Formin homology (FH) proteins in these processes. The protein encoded by this gene contains FH domains and belongs to a novel FH protein subfamily implicated in cell polarity. Wnt/Fz signaling activates the small GTPase Rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Activation requires Dvl-Rho complex formation, an assembly mediated by this gene product, which is thought to function as a scaffolding protein. Evidence of alternative splicing has been observed for this gene but the full-length nature of these variants has not been determined. (provided by RefSeq)

Immunogen

DAAM1 (NP_055807, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAPRKRGGRGISFIFCCFRNNDHPEITYRLRNDSNFALQTMEPALPMPPVEELDVMFSELVDELDLTDKHREAMFALPAEKKWQIYCSKKKDQEENKGATSWPEFYIDQL

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable