SAB1404827

Monoclonal Anti-OLFM1 antibody produced in mouse

clone 2E9-1A2, purified immunoglobulin, buffered aqueous solution

• Synonym(s): AMY, NOE1, NOELIN1, OlfA
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 2E9-1A2, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~44.7 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable
• isotype: IgG1κ
• NCBI accession no.: BC000189
• UniProt accession no.: Q99784
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... OLFM1(10439)

Description

General description

This gene product shares extensive sequence similarity with the rat neuronal olfactomedin-related ER localized protein. While the exact function of the encoded protein is not known, its abundant expression in brain suggests that it may have an essential role in nerve tissue. Several alternatively spliced transcripts encoding different isoforms have been found for this gene. (provided by RefSeq)

Immunogen

OLFM1 (AAH00189, 1 a.a. ~ 169 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MPGRWRWQRDMHPARKLLSLLFLILMGTELTQNKRENKAEKMGGPESERKTTGEKTLNELPLFCLEAHAGSLALPRMCSPNPNPAVGLCRPAYPQSPSPGAAQTISQSLLERFCMASRREVFLAPGRPGGGWWLCTVAGQMHSFMCTHTHTHAHTGEQIPAEKSQPGPD

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable