SAB1404343

Monoclonal Anti-RXRG, (N-terminal) antibody produced in mouse

clone 1B2, ascites fluid

• Synonym(s): NR2B3, RXRC
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: ascites fluid
• antibody product type: primary antibodies
• clone: 1B2, monoclonal
• mol wt: antigen ~29.63 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable
• isotype: IgMκ
• NCBI accession no.: NM_001009598
• UniProt accession no.: P48443
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... RXRG(6258)

Description

General description

This gene encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the antiproliferative effects of retinoic acid (RA). This receptor forms dimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. This gene is expressed at significantly lower levels in non-small cell lung cancer cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. (provided by RefSeq)

Immunogen

RXRG (-, 1 a.a. ~ 33 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MYGNYSHFMKFPAGYGGCSSPALQLLLSTSLG

Physical form

Clear solution

Safety Information

• Storage Class: 11 - Combustible Solids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable