SAB1404094
Monoclonal Anti-MUC5AC antibody produced in mouse
clone 2A4, purified immunoglobulin, buffered aqueous solution
Synonym(s):
MUC5
Sign Into View Organizational & Contract Pricing
Select a Size
100 μG
$541.00
$541.00
Ships within 2 weeks. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)
All Photos(2)
Select a Size
Change View
100 μG
$541.00
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
$541.00
Ships within 2 weeks. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)
Recommended Products
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
2A4, monoclonal
form
buffered aqueous solution
mol wt
antigen ~37.11 kDa
species reactivity
human
technique(s)
capture ELISA: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL
isotype
IgG2bκ
NCBI accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... MUC5AC(4586)
General description
The MUC5AC (mucin 5AC, oligomeric mucus/gel-forming) gene is mapped to human chromosome 11p15.5. Muc5ac is a gel-forming mucin of 40MDa, secreted by the goblet cells of the conjunctiva. Muc5ac is localized to the intermediate aqueous layer of tear film and predominant mucin in the respiratory tract. Muc5ac protein consists of cysteine-rich domains that flanks the central glycosylated tandem repeat domain.
Immunogen
MUC5AC (XP_495860, 351 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
NQSTCAVYHRSLIIQQQGCSSSEPVRLAYCRGNCGDSSSMYSLEGNTVEHRCQCCQELRTSLRNVTLHCTDGSSRAFSYTEVEECGCMGRRCPAPGDTQH
Sequence
NQSTCAVYHRSLIIQQQGCSSSEPVRLAYCRGNCGDSSSMYSLEGNTVEHRCQCCQELRTSLRNVTLHCTDGSSRAFSYTEVEECGCMGRRCPAPGDTQH
Application
Muc5ac (mucin 5AC, oligomeric mucus/gel-forming) provides hydration and lubrication effect for epithelial cells that make up cornea and conjunctiva. Parasympathetic and sympathetic nervous system (particularly, parasympathetic neurotransmitters acetylcholine and vasoactive intestinal peptide) controls the Muc5ac secretion. A number pathogens and cytokines can also stimulate Muc5ac secretion in the airway. MUC5AC gene expression is associated with a some pathological conditions such as allergen-induced airway hyperresponsiveness,airway mucus plugging, and mucous metaplasia.
Physical form
Solution in phosphate buffered saline, pH 7.4
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk_germany
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Lot/Batch Number
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Impact of Cigarette Smoking on Tear Function and Correlation between Conjunctival Goblet Cells and Tear MUC5AC Concentration in Office Workers.
Yuichi U, et al.
Scientific Reports, 6, 27699-27699 (2016)
Effect of epithelium ATP release on cyclic pressure-induced airway mucus secretion.
Jin T, et al.
Bioscience Reports, 34(1), e00088-e00088 (2014)
Abnormalities in MUC5AC and MUC5B Protein in Airway Mucus in Asthma.
Marrah E L S, et al.
American Journal of Respiratory and Critical Care Medicine, 194(10), 1296-1299 (2016)
Genomic organization of the 3′ -region of the human MUC5AC mucin gene:additional evidence for a common ancestral gene for the 11p15.5 mucin gene family.
Buisine M P, et al.
The Biochemical Journal, 332(3), 729-738 (1998)
Interleukin-33 induces mucin gene expression and goblet cell hyperplasia in human nasal epithelial cells.
Hajime I, et al.
Cytokine, 90, 60-65 (2017)
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service
