SAB1403675

Monoclonal Anti-CLCN7, (C-terminal) antibody produced in mouse

clone 4A3, ascites fluid

• Synonym(s): CLC-7, CLC7, FLJ26686, FLJ39644, FLJ46423, OPTA2, OPTB4
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: ascites fluid
• antibody product type: primary antibodies
• clone: 4A3, monoclonal
• mol wt: antigen ~37.11 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1:500-1:1000
• isotype: IgG2aκ
• NCBI accession no.: NM_001287
• UniProt accession no.: P51798
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... CLCN7(1186)

Description

General description

The product of this gene belongs to the CLC chloride channel family of proteins. Chloride channels play important roles in the plasma membrane and in intracellular organelles. This gene encodes chloride channel 7. Defects in this gene are the cause of osteopetrosis autosomal recessive type 4 (OPTB4), also called infantile malignant osteopetrosis type 2 as well as the cause of autosomal dominant osteopetrosis type 2 (OPTA2), also called autosomal dominant Albers-Schonberg disease or marble disease autosoml dominant. Osteopetrosis is a rare genetic disease characterized by abnormally dense bone, due to defective resorption of immature bone. OPTA2 is the most common form of osteopetrosis, occurring in adolescence or adulthood. (provided by RefSeq)

Immunogen

CLCN7 (NP_001278, 706 a.a. ~ 805 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LRLKDFRDAYPRFPPIQSIHVSQDERECTMDLSEFMNPSPYTVPQEASLPRVFKLFRALGLRHLVVVDNRNQVVGLVTRKDLARYRLGKRGLEELSLAQT

Physical form

Clear solution

Safety Information

• Storage Class: 11 - Combustible Solids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable