SAB1403351

Monoclonal Anti-VPS16, (C-terminal) antibody produced in mouse

clone 2F10, purified immunoglobulin, buffered aqueous solution

• Synonym(s): hVPS16
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 2F10, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~35.57 kDa
• species reactivity: human
• technique(s): immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• NCBI accession no.: NM_022575
• UniProt accession no.: Q9H269
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... VPS16(64601)

Description

General description

Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. This gene encodes the human homolog of yeast class C Vps16 protein. The mammalian class C Vps proteins are predominantly associated with late endosomes/lysosomes, and like their yeast counterparts, may mediate vesicle trafficking steps in the endosome/lysosome pathway. Two transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Immunogen

VPS16 (NP_072097.2, 754 a.a. ~ 839 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
IGYLPFVEICMKQHNKYEAKKYASRVGPEQKVKALLLVGDVAQAADVAIEHRNEAELSLVLSHCTGATDGATADKIQRARAQAQKK

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable