SAB1403268

Monoclonal Anti-SPA17 antibody produced in mouse

clone 3B6, purified immunoglobulin, buffered aqueous solution

• Synonym(s): SP17, SP17-1
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 3B6, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~37 kDa
• species reactivity: human
• technique(s): capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• NCBI accession no.: NM_017425
• UniProt accession no.: Q15506
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SPA17(53340)

Description

General description

Sperm autoantigenic protein 17 (SPA17) gene encodes a protein present at the cell surface. The N-terminus has sequence similarity to human cAMP-dependent protein kinase A (PKA) type II alpha regulatory subunit (RIIa) while the C-terminus has an IQ calmodulin-binding motif. The central portion of the protein has carbohydrate binding motifs and likely functions in cell-cell adhesion. The protein was initially characterized by its involvement in the binding of sperm to the zona pellucida of the oocyte. Recent studies indicate that it is also involved in additional cell-cell adhesion functions such as immune cell migration and metastasis. A retrotransposed pseudogene is present on chromosome 10q22. SPA17 gene is located on human chromosome 11q24.2. This antigenic protein contains 151 amino acids and has a molecular weight of 17.4 kDa. This protein is highly expressed in testis and in somatic tissues.

Immunogen

SPA17 (NP_059121, 51 a.a. ~ 149 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQNEEKEE

Biochem/physiol Actions

Sperm autoantigenic protein 17 (SPA17) functions as a testis specific antigen. It also mediates signal transduction, protein synthesis and unregulated growth in proliferating and neoplastic cells. Overexpression of this protein decreases the resistance of epithelial ovarian carcinoma to chemotherapy. It regulates protein kinase A-independent AKAP (A-kinase anchoring proteins) complex in both germinal and somatic cells.160 The gene is associated with rheumatoid arthritis (RA).

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable