SAB1403129

Monoclonal Anti-SULF1, (C-terminal) antibody produced in mouse

clone 1A4, ascites fluid

• Synonym(s): FLJ30905, FLJ38022, FLJ41750, HSULF-1, KIAA1077, SULF-1
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: ascites fluid
• antibody product type: primary antibodies
• clone: 1A4, monoclonal
• mol wt: antigen ~36.23 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1:500-1:1000
• isotype: IgMκ
• NCBI accession no.: NM_015170
• UniProt accession no.: Q8IWU6
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SULF1(23213)

Description

General description

Heparan sulfate proteoglycans (HSPGs) act as coreceptors for numerous heparin-binding growth factors and cytokines and are involved in cell signaling. Heparan sulfate 6-O-endosulfatases, such as SULF1, selectively remove 6-O-sulfate groups from heparan sulfate. This activity modulates the effects of heparan sulfate by altering binding sites for signaling molecules (Dai et al., 2005 [PubMed 16192265]).[supplied by OMIM

Immunogen

SULF1 (NP_055985.1, 780 a.a. ~ 871 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RTVNETHNFLFCEFATGFLEYFDMNTDPYQLTNTVHTVERGILNQLHVQLMELRSCQGYKQCNPRPKNLDVGNKDGGSYDLHRGQLWDGWEG

Physical form

Clear solution

Safety Information

• Storage Class: 11 - Combustible Solids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable