SAB1402753

Monoclonal Anti-DOCK1 antibody produced in mouse

clone 3D10, purified immunoglobulin, buffered aqueous solution

• Synonym(s): DOCK180, ced5
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 3D10, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~37.77 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2bκ
• NCBI accession no.: NM_001380
• UniProt accession no.: Q14185
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... DOCK1(1793)

Description

General description

This gene product binds to the SH3 domain of CRK protein. It may regulate cell surface extension and may have a role in the cell surface extension of an engulfing cell around a dying cell during apoptosis. (provided by RefSeq)

Immunogen

DOCK1 (NP_001371, 698 a.a. ~ 803 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LETYIKKHFSATLAYTKLTKVLKNYVDGAEKPGVNEQLYKAMKALESIFKFIVRSRILFNQLYENKGEADFVESLLQLFRSINDMMSSMSDQTVRVKGAALKYLPT

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable