SAB1402466

Monoclonal Anti-PRSS15 antibody produced in mouse

clone 3B2, purified immunoglobulin, buffered aqueous solution

• Synonym(s): LON, LONP, LonHS, MGC1498, PIM1, PRSS15, hLON
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 3B2, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~37.22 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• NCBI accession no.: NM_004793
• UniProt accession no.: P36776
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... LONP1(9361)

Description

General description

This gene encodes a mitochondrial matrix protein in the Lon family of ATP-dependent proteases. A similar E. coli protein regulates gene expression by targeting specific regulatory proteins for degradation. This protein binds a specific sequence in the light and heavy chain promoters of the mitochondrial genome which are involved in regulation of DNA replication and transcription. (provided by RefSeq)

Immunogen

PRSS15 (NP_004784.2, 661 a.a. ~ 761 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
YVAQEKLAIAERYLVPQARALCGLDESKAKLSSDVLTLLIKQYCRESGVRNLQKQVEKVLRKSAYKIVSGEAESVEVTPENLQDFVGKPVFTVERMYDVTP

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable