SAB1402269

Monoclonal Anti-MAP3K3 antibody produced in mouse

clone 1H3, purified immunoglobulin, buffered aqueous solution

• Synonym(s): MAPKKK3, MEKK3
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 1H3, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~35.9 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• NCBI accession no.: BC010464
• UniProt accession no.: Q99759
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... MAP3K3(4215)

Description

General description

This gene product is a 626-amino acid polypeptide that is 96.5% identical to mouse Mekk3. Its catalytic domain is closely related to those of several other kinases, including mouse Mekk2, tobacco NPK, and yeast Ste11. Northern blot analysis revealed a 4.6-kb transcript that appears to be ubiquitously expressed. This protein directly regulates the stress-activated protein kinase (SAPK) and extracellular signal-regulated protein kinase (ERK) pathways by activating SEK and MEK1/2 respectively; it does not regulate the p38 pathway. In cotransfection assays, it enhanced transcription from a nuclear factor kappa-B (NFKB)-dependent reporter gene, consistent with a role in the SAPK pathway. Alternatively spliced transcript variants encoding distinct isoforms have been observed. (provided by RefSeq)

Immunogen

MAP3K3 (AAH10464.1, 1 a.a. ~ 89 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MNEANVMLPYSGKEEPVLPVAMTLPLPGRGPRCGTAATEGGSSFVNAVVSVLQVGVTLMLYPVSKLETVCALWALSTPALGLGLGCIEK

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable